PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA01g05840
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family HD-ZIP
Protein Properties Length: 165aa    MW: 18897.7 Da    PI: 10.013
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA01g05840genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox597.5e-191468256
                T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                rk+ +++k+q  +Lee F+++++++ +++  LAk+lgL  rqV vWFqNrRa+ k
  CA01g05840 14 RKKLRLSKDQSVILEESFKEHNTLNPKQKLALAKRLGLRPRQVEVWFQNRRARTK 68
                788899***********************************************98 PP

2HD-ZIP_I/II129.71.2e-4114103191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  +kk+rlsk+q+ +LEesF+e+++L+p++K +la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+kev+eLr +l
   CA01g05840  14 RKKLRLSKDQSVILEESFKEHNTLNPKQKLALAKRLGLRPRQVEVWFQNRRARTKLKQTEVDCEFLKRCCENLTEENRRLQKEVQELR-AL 103
                  69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.63E-18971IPR009057Homeodomain-like
PROSITE profilePS5007117.1671070IPR001356Homeobox domain
SMARTSM003898.4E-161274IPR001356Homeobox domain
CDDcd000862.63E-131471No hitNo description
Gene3DG3DSA:1.10.10.606.1E-181468IPR009057Homeodomain-like
PfamPF000462.8E-161468IPR001356Homeobox domain
PRINTSPR000311.2E-54150IPR000047Helix-turn-helix motif
PROSITE patternPS0002704568IPR017970Homeobox, conserved site
PRINTSPR000311.2E-55066IPR000047Helix-turn-helix motif
PfamPF021839.1E-1270104IPR003106Leucine zipper, homeobox-associated
SMARTSM003404.2E-2770113IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 165 aa     Download sequence    Send to blast
MERGSDEEDG ETSRKKLRLS KDQSVILEES FKEHNTLNPK QKLALAKRLG LRPRQVEVWF  60
QNRRARTKLK QTEVDCEFLK RCCENLTEEN RRLQKEVQEL RALKLSPQFY MQMTPPTTLT  120
MCPSCERVGA PPSSSSGPTS TPMGQAQPRP MPFNLWANAL HPRS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11218SRKKLRL
26270RRARTKLKQ
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0107831e-136AP010783.1 Solanum lycopersicum DNA, chromosome 8, clone: C08HBa0006F21, complete sequence.
GenBankHG9755201e-136HG975520.1 Solanum lycopersicum chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016570126.11e-118PREDICTED: homeobox-leucine zipper protein HAT4-like
SwissprotQ054665e-82HAT4_ARATH; Homeobox-leucine zipper protein HAT4
TrEMBLA0A0V0HV351e-115A0A0V0HV35_SOLCH; Putative homeobox-leucine zipper protein HAT4-like
STRINGPGSC0003DMT4000675401e-103(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11182485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.15e-79homeobox protein 2